ESTScan Details for Unigene SGN-U636211

Score 
1764
Direction 
Forward
Predicted Peptide Sequence 
XSTAATIQLVQKADVKIRXEQEIYASEFPEAQMWQPFSSIYRSPPPNLTGDHHSLGSYSPGQQKKQPDSVSLSFEAKNFPQRLISLERKS
SLVSKLAMAGSGVFAEITDGDEFKYYFEGEWKKSASGKSVSIINPTTRKTQYKVQACTQEEVNKVMEIAKAAQKLWAKTPLWKRAELLHK
AAAILKEHKAPIAECLVKEIAKPAKDAVTEVVRSGDLVSYTAEEGVRILGQGTYLVSDSFPGNERTKYCLSSKIPLGVVLAIPPFNYPVN
LAVSKLAPALIAGNSIVLKPPTQGAVSALHMVHCFHLAGFPKGLINCVTGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKAGMIPLQM
ELGGKDACIVLEDADLDLVAANIVKGGFSYSGQRCTAVKVVLVMESVADDLVAKVNAKVAKLKVGPPEDDCDITAVVSESSANFIEGLVM
DAKQKGATFCQEYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRITSAEEGIHHCNASNFGLQGCVFTKDINKAMLISDAMETGTV
QINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMVKVKSTVINLPCPSYTMG*
Predicted Coding Sequence 
XXCTCCACAGCTGCCACGATCCAGTTGGTCCAAAAAGCTGATGTCAAAATCCGAGAXGAACAAGAAATCTATGCCTCAGAATTCCCTGAA
GCCCAAATGTGGCAACCATTTTCCTCTATTTATAGGTCCCCACCTCCAAATCTCACCGGTGATCATCACTCGCTAGGTAGCTACTCXCCA
GGGCAGCAGAAGAAACAACCTGATTCTGTTTCTCTGAGCTTTGAAGCTAAAAATTTCCCTCAGAGGTTGATCAGTCTTGAGAGGAAAAGC
AGTTTAGTGTCTAAATTAGCAATGGCTGGGAGTGGAGTTTTTGCTGAGATTACTGATGGAGATGAGTTCAAGTACTACTTTGAAGGGGAG
TGGAAGAAGTCTGCTTCTGGGAAATCTGTTTCTATCATTAATCCAACTACGCGAAAAACTCAGTACAAAGTACAAGCATGTACACAAGAA
GAGGTTAACAAGGTAATGGAAATAGCTAAGGCTGCACAAAAGTTATGGGCCAAAACTCCACTTTGGAAGCGCGCAGAGCTGCTTCACAAG
GCCGCTGCTATTCTCAAAGAGCACAAAGCGCCAATTGCAGAATGTCTAGTAAAGGAGATTGCAAAACCAGCAAAAGATGCTGTCACTGAG
GTCGTGAGGTCTGGAGATCTGGTTTCTTACACTGCTGAAGAAGGAGTAAGGATTTTGGGACAGGGCACATACTTGGTCTCTGATAGTTTT
CCTGGAAATGAGAGGACCAAATACTGCCTCAGTTCCAAGATCCCACTTGGTGTTGTCCTAGCCATTCCCCCCTTTAACTATCCTGTTAAC
CTTGCCGTCTCCAAACTAGCACCTGCCTTGATTGCTGGGAATTCTATTGTTCTCAAGCCTCCAACTCAGGGTGCTGTGTCAGCCCTACAT
ATGGTTCATTGTTTCCACTTAGCTGGCTTTCCAAAGGGCCTTATTAACTGTGTCACTGGGAAAGGTTCTGAGATTGGTGATTTCCTCACC
ATGCATCCTGGTGTGAACTGTATAAGCTTTACTGGCGGTGACACTGGGATTGCGATCTCAAAGAAAGCAGGCATGATCCCCTTACAAATG
GAGCTGGGAGGAAAAGATGCTTGTATTGTCCTTGAGGATGCAGATTTAGATTTGGTTGCAGCAAATATTGTCAAAGGAGGTTTTTCTTAC
AGTGGTCAAAGGTGCACAGCTGTTAAGGTTGTTTTGGTGATGGAATCTGTGGCTGATGATCTTGTTGCAAAAGTAAATGCCAAAGTAGCA
AAACTAAAAGTTGGACCTCCCGAAGATGATTGTGATATCACTGCAGTTGTCTCAGAGTCATCGGCAAACTTCATTGAAGGGTTAGTTATG
GATGCTAAGCAGAAGGGCGCAACATTTTGCCAGGAATACAAAAGAGAGGGCAATCTCATCTGGCCACTTTTGCTAGACCATGTTAGGCCA
GACATGAGGATAGCATGGGAGGAGCCATTTGGGCCAGTTTTGCCAGTGATTAGGATTACCTCTGCTGAAGAAGGAATTCACCATTGCAAT
GCAAGCAATTTTGGCCTACAGGGTTGTGTCTTCACCAAAGATATCAACAAAGCTATGTTGATCAGCGATGCCATGGAGACGGGAACCGTC
CAGATTAACTCCGCTCCAGCTCGTGGACCGGATCATTTTCCCTTCCAGGGAATTAAGGACAGTGGAATAGGATCACAAGGCATCACCAAC
AGCATTAACATGATGGTTAAGGTCAAGAGCACTGTGATTAACTTGCCATGCCCATCCTACACAATGGGCTAA
Edits in Original Sequence 
(5')XXCTCCACAGCTGCCACGATCCAGTTGGTCCAAAAAGCTGATGTCAAAATCCGAGAXGAACAAGAAATCTATGCCTCAGAATTCCC
TGAAGCCCAAATGTGGCtAACCATTTTCCTCTATTTATAGGTCCCCACCTCCAAATaCTCACCGGTGATCATCACTCGCTAGGTAGCTAC
TCXCCAGGGCAGCAGAAGAAACAACCTGATTCTGTTTCTCTGAGCTTTGAAGCTAAAAATTTCCCTCAGAgGGTTGATCAGTCTTGAGAG
GAAAAGCAGTTTAGTGTCTAAATTAGCAATGGCTGGGAGTGGAGTTTTTGCTGAGATTACTGATGGAGATGAGTTCAAGTACTACTTTGA
AGGGGAGTGGAAGAAGTCTGCTTCTGGGAAATCTGTTTCTATCATTAATCCAACTACGCGAAAAACTCAGTACAAAGTACAAGCATGTAC
ACAAGAAGAGGTTAACAAGGTAATGGAAATAGCTAAGGCTGCACAAAAGTTATGGGCCAAAACTCCACTTTGGAAGCGCGCAGAGCTGCT
TCACAAGGCCGCTGCTATTCTCAAAGAGCACAAAGCGCCAATTGCAGAATGTCTAGTAAAGGAGATTGCAAAACCAGCAAAAGATGCTGT
CACTGAGGTCGTGAGGTCTGGAGATCTGGTTTCTTACACTGCTGAAGAAGGAGTAAGGATTTTGGGACAGGGCACATACTTGGTCTCTGA
TAGTTTTCCTGGAAATGAGAGGACCAAATACTGCCTCAGTTCCAAGATCCCACTTGGTGTTGTCCTAGCCATTCCCCCCTTTAACTATCC
TGTTAACCTTGCCGTCTCCAAACTAGCACCTGCCTTGATTGCTGGGAATTCTATTGTTCTCAAGCCTCCAACTCAGGGTGCTGTGTCAGC
CCTACATATGGTTCATTGTTTCCACTTAGCTGGCTTTCCAAAGGGCCTTATTAACTGTGTCACTGGGAAAGGTTCTGAGATTGGTGATTT
CCTCACCATGCATCCTGGTGTGAACTGTATAAGCTTTACTGGCGGTGACACTGGGATTGCGATCTCAAAGAAAGCAGGCATGATCCCCTT
ACAAATGGAGCTGGGAGGAAAAGATGCTTGTATTGTCCTTGAGGATGCAGATTTAGATTTGGTTGCAGCAAATATTGTCAAAGGAGGTTT
TTCTTACAGTGGTCAAAGGTGCACAGCTGTTAAGGTTGTTTTGGTGATGGAATCTGTGGCTGATGATCTTGTTGCAAAAGTAAATGCCAA
AGTAGCAAAACTAAAAGTTGGACCTCCCGAAGATGATTGTGATATCACTGCAGTTGTCTCAGAGTCATCGGCAAACTTCATTGAAGGGTT
AGTTATGGATGCTAAGCAGAAGGGCGCAACATTTTGCCAGGAATACAAAAGAGAGGGCAATCTCATCTGGCCACTTTTGCTAGACCATGT
TAGGCCAGACATGAGGATAGCATGGGAGGAGCCATTTGGGCCAGTTTTGCCAGTGATTAGGATTACCTCTGCTGAAGAAGGAATTCACCA
TTGCAATGCAAGCAATTTTGGCCTACAGGGTTGTGTCTTCACCAAAGATATCAACAAAGCTATGTTGATCAGCGATGCCATGGAGACGGG
AACCGTCCAGATTAACTCCGCTCCAGCTCGTGGACCGGATCATTTTCCCTTCCAGGGAATTAAGGACAGTGGAATAGGATCACAAGGCAT
CACCAACAGCATTAACATGATGGTTAAGGTCAAGAGCACTGTGATTAACTTGCCATGCCCATCCTACACAATGGGCTAA(3')TCATTTC
AATAGCTAATTAGCACCCAATAATTTCCCGTGTGTTGTTAACAACAACACAGCAACTACATAGAATTAATTAGAATCTTGAATAGTTCTC
CTGGAGCTAACGTCGGAGACAAAGGTGAAGAATAACCTCTATTATTCTGTTTTTGCACTGAATATATATATATTATGTTGTTTGATGGAG
TAGCCTCCTATTGTCTATTTTGATGATGAAAATTGAGGCATATTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan