Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U636243

Score 
173
Direction 
Forward
Predicted Peptide Sequence 
IEADKYGDDVLSAGEVFNQDSLKVLEADIQHANALAAEIPRAKGGARLQMKLVYNHLAPLFLFFFNGWIVPAHXLLPRYLNLFHVLIYKV
YTDGRPRISRHGRKATVNXLLRNYTTITAALHGDLVEVDDATERNCALKNIGKKRLEGGTGFTNFDLEREDXMWNLLRAMYQNGVALTAV
MLCASIATAIGTLGLNLARFVVVAKESQVERFMX
Predicted Coding Sequence 
ATAGAAGCAGATAAGTATGGAGATGATGTATTATCAGCTGGGGAGGTCTTCAATCAGGATTCCCTTAAAGTTCTGGAGGCTGATATACAG
CACGCTAATGCTCTGGCTGCTGAAATTCCTAGAGCAAAAGGCGGAGCGCGCCTTCAAATGAAGTTAGTTTACAATCACTTAGCACCTCTC
TTTCTGTTCTTCTTCAATGGATGGATTGTTCCTGCACATGXTCTGCTTCCAAGATATCTAAATCTTTTCCATGTACTTATCTATAAGGTT
TACACAGATGGGAGACCAAGAATATCTAGACACGGAAGGAAAGCAACTGTTAATGXACTTCTACGCAATTATACTACCATCACTGCAGCA
CTTCATGGAGACTTAGTAGAGGTTGATGATGCAACAGAAAGGAATTGTGCCCTTAAAAACATTGGCAAGAAACGACTGGAAGGCGGTACT
GGATTTACCAACTTCGACTTGGAGAGGGAAGATGAXATGTGGAATCTGCTTAGAGCCATGTACCAAAATGGTGTTGCXCTAACTGCTGTC
ATGCTATGTGCATCAATTGCTACCGCGATTGGAACACTAGGTCTGAATCTTGCCCGTTTTGTCGTGGTAGCAAAAGAGAGTCAAGTCGAG
AGATTTATGGXX
Edits in Original Sequence 
GGGACCCCAAATGCTCAAACTTCGCTTCGTCTTCGGAAGACTAAAGAATTCCTTAGCAACATAATCATCATTTTCTGTCTGACCAACAAA
ACCGAAACCTGTCATCCTCAGAGCCGCCCCTTCCCTTTATCTCAAGAAAAGATGTACTGTACTACTTCGAGAAAGTTATTCGGAGGAGGG
GTTTGAAATAGGGAAAGAGAGAGAGATTAAAAGAATTTCTGTTGCTTCCCATTCTTTTATATTCTTCTCTTGTCCTTACCTTAAGAGTTA
AGACTAAACCTTGTGGTTTTCGCAAGCTCTTTAATTTTCGTGACAGTAAGAGTTCCCTCCTCCTGTCTTTTACTCTTAACTTCCTGATTA
AGAGAGAGGCCATTTCTTGATTAAATACGGAG
(5')ATAGAAGCAGATAAGTATGGAGATGATGTATTATCAGCTGGGGAGGTCTTCAtA
TCAGGATTCCCTTAAAGTTCTGGAGGCTGATATACAGCACGCTAATGCTCTGGCTGCTGAAATTCCTAGAGCAAAAGGCGGAGCGCGCCT
TCAAATGAAGTTAGTTTACAATCACTTAGCACCTCTCTTTCTGTTCTTaCTTCAATGGATGGATTGTTCCTGCACATGXTCTGCTTCCAA
GATATCTAAATCTTTTCCATGTACTTATCTATAAGGTTTACACAGATGGGAGACCAAGAATATCTAGACACGGAAGGAAAGCAACTGTTA
ATGXACTTCTACGCAATTATACTACCATCACTGCAGCgACTTCATGGAGACTTAGTAGAGGTTGATGATGCAACAGAAAGGAATTGTGCC
CTTAAAAACATTGGCAAGAAACGACTGGAAGGCGGTACTGGATTTACCAACTTCGACTTGGAGAGGGAAGATGAXATGTGGAATCTGCTT
AGAGCCATGTACCAAAATGGTGTTGCXCTAACTGCTGTCATGCTATGTGCATCAATTGCTACCGCGATTGGAACACTAGGTCTGAATCTT
GCCCGTTTTGTCGTGGTAGCAtAAAGAGAGTCAAGTCGAGAGATTTATGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan