ESTScan Details for Unigene SGN-U636593

Score 
523
Direction 
Forward
Predicted Peptide Sequence 
XAGGKGSKRKFERAALELETFSPFTTFVCCKARKESILGGKFLPNLKVPSQPSFTINSESLAQVFLHNTSSKSSHFPLSYHFVVSKAKPY
LNXEPVVSFRLAKKKKNMGVSGTLEYLSDMVSSGHKHKKKKQMQTVELKVRMDCEGCELKVKKALSSLSGVKTVEINRKLQKATVTGYVE
PNKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVQSYDKKAPPGYVRKVEYPTTGTVTRYDQDPYISMFSDENPNACSIM*
Predicted Coding Sequence 
XXGGCCGGGGGAAAAGGAAGTAAAAGAAAGTTTGAAAGGGCAGCTTTAGAATTAGAAACCTTTTCCCCTTTTACTACCTTTGTTTGCTGT
AAGGCAAGGAAAGAATCCATTCTTGGAGGGAAGTTTCTTCCAAATCTTAAAGTACCATCTCAACCATCTTTTACTATAAATTCAGAGTCT
CTTGCCCAAGTTTTCTTGCATAATACCTCTTCCAAATCAAGCCATTTTCCTTTGTCATACCATTTCGTTGTTTCCAAAGCTAAACCATAC
CTTAATAAXGAACCAGTAGTTTCTTTTAGACTTGCAAAAAAAAAAAAAAATATGGGTGTTAGTGGAACTTTGGAGTACCTTTCTGACATG
GTGAGCAGCGGCCATAAACACAAGAAGAAGAAACAAATGCAAACTGTGGAGCTCAAAGTCAGAATGGACTGTGAAGGATGCGAGCTTAAA
GTCAAAAAAGCTTTGTCTTCATTAAGTGGAGTTAAAACTGTGGAGATAAACAGGAAACTGCAGAAGGCAACGGTGACAGGATATGTGGAA
CCAAACAAAGTGTTGAAAAAGGCTAAATCAACAGGAAAGAAGGCGGAGATATGGCCATATGTACCATATAACCTGGTGGCTCAGCCGTAT
GCCGTCCAATCTTACGACAAGAAAGCACCTCCGGGCTATGTCAGAAAGGTGGAGTACCCAACAACCGGGACAGTAACAAGATATGATCAA
GACCCTTACATCTCCATGTTCAGTGATGAGAATCCCAATGCTTGCTCCATTATGTAA
Edits in Original Sequence 
(5')XXGGCCGGGGGAAAAGGAAGTAAAAGAAAGTTTGAAAGGGCAGCTTTAGAATTAGAAACCTTTTCCCCTTTTACTACCTTTGTTTG
CTGTAAGGCAAGGAAAGAATCCAtTTCTTGGAGGGAAGTTTCTTCCAAATCTTAAAGTACCATCTCAACCATCTTTTACTATAAATTCAG
AGTCTCTTcGCCCAAGTTTTCTTGCATAATACCTCTTCCAAATCAAGCCATTTTCCTTTGTCATACCATTTCGTTGTTTCCAAAGCTAAA
CCATACCTTAATAAXGAACCAGTAGTTTCTTTTAGACTTGCAAAAAAAAAAAAAAATATGGGTGTTAGTGGAACTTTGGAGTACCTTTCT
GACATGGTGAGCAGCGGCCATAAACACAAGAAGAAGAAACAAATGCAAACTGTGGAGCTCAAAGTCAGAATGGACTGTGAAGGATGCGAG
CTTAAAGTCAAAAAAGCTTTGTCTTCATTAAGTGGAGTTAAAACTGTGGAGATAAACAGGAAACTGCAGAAGGCAACGGTGACAGGATAT
GTGGAACCAAACAAAGTGTTGAAAAAGGCTAAATCAACAGGAAAGAAGGCGGAGATATGGCCATATGTACCATATAACCTGGTGGCTCAG
CCGTATGCCGTCCAATCTTACGACAAGAAAGCACCTCCGGGCTATGTCAGAAAGGTGGAGTACCCAACAACCGGGACAGTAACAAGATAT
GATCAAGACCCTTACATCTCCATGTTCAGTGATGAGAATCCCAATGCTTGCTCCATTATGTAA(3')TGCATATATATTCAATATTAATG
TAAGAAGACTAGAACTAGTACTAGATGCCCTTTTGCAATATATTGCAATATAGGCACTCTTTTTGTCAACCTTTTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan