Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U636900

Score 
1049
Direction 
Forward
Predicted Peptide Sequence 
XAGGDAVSLVPSFLLLFLSSFFXLIATQLCSMQGYFTAFASSLALKLFKPKISNGSNKQVRSDKTSIDGTPQESDFELKTEALSLSIEPG
KKELIVKILYLSIDPYQLNRMKQKSSSQETTSSARAVKPFEAIDAHGVGRVVASGNPAFKEDDLVAGLLTWGEYCTVKEGGLLNKVDNIG
FPISHHVGVLAFSGLTAYAGFFEVCKPKKGEKVFVSAAAGSVGNLVGQYAKLFGCYVVGCAGSQKKVDLLKEKLGFDEAFNYKEETDLKS
ALKRYFPDGIDIYFDNVGAEMLEAAVENMNTFGRVAVCGAISEYTDKGKRAAPNMVDVIYKRITMQGFLAGDHMKVYKDFISDTVEHIQA
GKLQVLEDISHGLESIPSAFVGLFRGDNIGKKMVQVADD*IIDHFTRVSTNKYILRGEKKRLNLMAPQLATSLVIDNGTSRIKESFQX
Predicted Coding Sequence 
XXGGCCGGGGGAGACGCTGTTTCTCTTGTTCCATCTTTCCTTCTTCTGTTTCTTTCTTCCTTTTTTXTTTTAATTGCCACTCAACTATGT
TCCATGCAGGGTTATTTTACTGCTTTTGCTTCTTCTCTTGCACTGAAGTTGTTTAAGCCAAAGATTTCCAATGGAAGTAACAAACAGGTA
CGTAGTGACAAGACATCAATTGATGGAACACCACAAGAATCTGATTTTGAGCTCAAGACAGAGGCTCTTTCTTTATCTATTGAGCCTGGT
AAAAAGGAGCTCATTGTGAAAATTCTTTACTTATCCATTGATCCATACCAATTGAACCGCATGAAGCAAAAAAGTTCCTCGCAGGAAACC
ACAAGCTCTGCACGTGCTGTTAAGCCTTTTGAGGCCATTGATGCTCATGGTGTTGGGAGAGTTGTTGCTTCGGGGAATCCCGCCTTTAAA
GAGGATGACTTAGTTGCCGGACTCCTGACTTGGGGAGAATACTGCACAGTAAAAGAAGGTGGCTTGCTAAACAAGGTTGATAACATAGGA
TTTCCCATTTCTCACCATGTAGGTGTTCTGGCATTCAGTGGGCTTACAGCTTATGCTGGATTTTTTGAGGTTTGTAAGCCAAAGAAAGGG
GAGAAAGTGTTTGTCTCTGCGGCTGCAGGATCTGTTGGAAATTTAGTAGGACAATATGCAAAGCTGTTTGGATGCTATGTTGTAGGATGT
GCTGGTAGCCAAAAAAAGGTGGACTTGCTAAAGGAGAAGCTTGGTTTTGATGAAGCATTCAACTACAAAGAAGAAACTGATCTGAAATCA
GCTCTCAAAAGGTACTTCCCAGATGGGATCGACATATACTTTGATAATGTGGGAGCAGAAATGCTGGAAGCTGCGGTTGAGAACATGAAT
ACATTCGGTAGAGTTGCTGTTTGTGGCGCTATATCTGAATATACGGACAAAGGAAAACGTGCTGCTCCAAACATGGTGGATGTTATTTAC
AAGAGGATAACAATGCAAGGATTTTTAGCTGGTGATCATATGAAAGTCTACAAGGATTTCATTTCAGACACAGTTGAGCACATTCAGGCA
GGAAAGTTGCAGGTGCTTGAAGACATTTCACATGGTTTGGAAAGCATACCATCTGCTTTTGTAGGTCTTTTCCGAGGCGATAATATAGGG
AAAAAGATGGTTCAAGTTGCAGATGATTGAATAATTGATCATTTCACTAGAGTTTCAACAAACAAATATATATTGAGGGGAGAGAAGAAG
AGGCTTAATCTCATGGCTCCCCAGCTTGCAACTTCTCTTGTAATCGATAATGGGACCTCACGAATCAAGGAGTCTTTTCAATXX
Edits in Original Sequence 
(5')XXGGCCGGGGGAGACGCTGTTTCTCTTGTTCCATCTTTCCTTCTTCTGTTTCTTTCTTCCTTTTTTXTTTTAATTGCCACTCAACT
ATGTTCCATaGCAGGGTTATTTTACTGCTTTTGCTTCTTCTCTTGCACTGAAGTTaGTTTAAGCCAAAGATTTCCAATGGAAGTAACAAA
CAGGTACGTAGTGACAAGACATCAtATTGATGGAACACCACAAGAATCTGATTTTGAGCTCAAGACAGAGGCTCTTTCTTTATCTATTGA
GCCTGGTAAAAAGGAGCTCATTGTGAAAATTCTTTACTTATCCATTGATCCATACCAATTGAACCGCATGAAGCAAAAAAGTTCCTCGCA
GGAAACCACAAGCTCTGCACGTGCTGTTAAGCCTTTTGAGGCCATTGATGCTCATGGTGTTGGGAGAGTTGTTGCTTCGGGGAATCCCGC
CTTTAAAGAGGATGACTTAGTTGCCGGACTCCTGACTTGGGGAGAATACTGCACAGTAAAAGAAGGTGGCTTGCTAAACAAGGTTGATAA
CATAGGATTTCCCATTTCTCACCATGTAGGTGTTCTGGCATTCAGTGGGCTTACAGCTTATGCTGGATTTTTTGAGGTTTGTAAGCCAAA
GAAAGGGGAGAAAGTGTTTGTCTCTGCGGCTGCAGGATCTGTTGGAAATTTAGTAGGACAATATGCAAAGCTGTTTGGATGCTATGTTGT
AGGATGTGCTGGTAGCCAAAAAAAGGTGGACTTGCTAAAGGAGAAGCTTGGTTTTGATGAAGCATTCAACTACAAAGAAGAAACTGATCT
GAAATCAGCTCTCAAAAGGTACTTCCCAGATGGGATCGACATATACTTTGATAATGTGGGAGCAGAAATGCTGGAAGCTGCGGTTGAGAA
CATGAATACATTCGGTAGAGTTGCTGTTTGTGGCGCTATATCTGAATATACGGACAAAGGAAAACGTGCTGCTCCAAACATGGTGGATGT
TATTTACAAGAGGATAACAATGCAAGGATTTTTAGCTGGTGATCATATGAAAGTCTACAAGGATTTCATTTCAGACACAGTTGAGCACAT
TCAGGCAGGAAAGTTGCAGGTGCTTGAAGACATTTCACATGGTTTGGAAAGCATACCATCTGCTTTTGTAGGTCTTTTCCGAGGCGATAA
TATAGGGAAAAAGATGGTTCAAGTTGCAGATGATTGAATAATTGATCATTTCACTAGAGTTTCAACAAACAAATATATATTGtAGGGGAG
AGAAGAAGAGGCTTAATCTCATGGCTCCCCAGCTTGCAACTTCTCTTGTAATCGATAATGGGACCTCACGAATCAAGGAGTCTTTTCAAT
XX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan