ESTScan Details for Unigene SGN-U637331

Score 
701
Direction 
Forward
Predicted Peptide Sequence 
MGIDYYHLLKVPKNASEEDLKKSYKRLAMKWHPDKNSENKKEAEAKFKTISEAYDVLSDPQKRQIYDLYGEEGLKSGQFSTASPTSAGGA
ASGRGFKFSPRNADDIFAEFFGGFDGNYAVSGGNGELKKAAPMENKLPCSLEELYKGSKRKMQISRIVLDDYGKPVTVEEVLSIHIKPGW
KKGTKITFPEKGNYELGRAPGDLIFVVDEKPHAVFKRDGNDLVMNQRISLLDALTGKTLSLTTLDGRELSIPVKDIVKPGHELRIPNEGM
PISKEPGKKGNLRIKFDIKFPPGSAQNKNLNCGGYLGGLLIVQNEALKNIATSYSGNAPGCKYIVTLLGLVGNTVHNRSMFNSVACNIFX
VVSGPKCSILAGVLVIDVNFGVQCSNLWNRXPNNGILDLVEVVCLVFCWHKYLDPVGEKPXTPMPRKGGQMKYPAPLFKKVERGTSASIY
LDNAAYRSFIYNKFNVSPVEMESAAVALVCHQQRVPFIVIRALSDLAGGGTAESNEAATFTALAADNSXPSCGGIPSDFTVFS
Predicted Coding Sequence 
ATGGGCATTGATTACTACCATTTATTGAAAGTACCGAAAAATGCAAGCGAAGAGGACCTGAAGAAGTCGTATAAGCGGCTCGCGATGAAG
TGGCATCCGGATAAGAACAGCGAGAACAAGAAAGAAGCGGAGGCCAAGTTCAAGACGATTTCAGAAGCGTATGATGTCTTAAGCGATCCC
CAAAAGCGGCAGATCTATGACTTGTACGGCGAGGAAGGCCTCAAGTCCGGCCAGTTTTCTACTGCTTCACCTACTAGTGCTGGTGGCGCT
GCTAGTGGGAGAGGATTTAAGTTTAGCCCTCGGAATGCGGATGATATTTTTGCTGAGTTTTTCGGTGGATTCGACGGGAATTATGCTGTT
AGCGGCGGCAATGGAGAGCTGAAGAAGGCTGCGCCGATGGAGAATAAGCTTCCCTGTAGCTTGGAGGAGCTGTATAAAGGATCTAAAAGG
AAGATGCAGATTTCCAGGATCGTCCTTGATGACTATGGCAAGCCTGTGACCGTGGAAGAGGTGTTGTCAATACATATTAAACCAGGTTGG
AAGAAGGGTACAAAGATTACATTCCCTGAGAAAGGGAACTACGAACTTGGTCGTGCTCCTGGGGATCTGATATTTGTAGTTGATGAAAAA
CCTCATGCTGTTTTCAAGAGGGATGGCAATGATCTTGTCATGAATCAGAGGATTTCCTTGCTGGACGCTCTCACTGGGAAGACTCTCAGC
TTGACAACCTTGGATGGAAGAGAGCTGAGCATCCCAGTCAAAGATATTGTCAAACCTGGCCATGAGCTGAGGATCCCAAATGAAGGGATG
CCCATATCAAAAGAACCTGGTAAGAAAGGAAATTTGAGGATTAAGTTTGATATAAAATTCCCTCCAGGCTCAGCTCAGAACAAAAATCTG
AACTGCGGAGGGTACTTGGGAGGACTGCTGATTGTCCAAAATGAAGCACTGAAGAATATAGCAACCAGTTATAGTGGAAACGCACCTGGA
TGTAAATACATCGTGACTTTGCTTGGACTAGTAGGAAACACTGTGCATAATAGGAGTATGTTTAATTCGGTCGCGTGCAATATATTTGAX
GTTGTGTCTGGCCCCAAGTGTAGCATATTGGCTGGTGTTCTAGTGATCGATGTTAATTTTGGTGTTCAATGTTCAAATCTGTGGAATAGA
AAXCCGAATAATGGTATTTTGGATTTGGTGGAGGTTGTCTGCCTCGTATTTTGTTGGCATAAATATCTTGATCCAGTTGGTGAAAAGCCG
GXGACCCCAATGCCCCGTAAAGGGGGCCAAATGAAGTACCCGGCCCCCCTTTTTAAAAAGGTTGAAAGAGGAACAAGTGCCAGCATTTAC
TTAGACAATGCAGCTTATAGGAGCTTCATATACAACAAGTTTAATGTGAGCCCTGTGGAGATGGAAAGTGCTGCAGTGGCTCTCGTTTGC
CATCAGCAAAGGGTTCCTTTCATTGTCATTAGGGCACTTTCCGACTTGGCCGGCGGTGGCACCGCTGAATCCAATGAGGCTGCTACTTTC
ACTGCTCTTGCAGCTGATAATTCTGXTCCAAGTTGTGGTGGAATTCCATCAGATTTTACTGTCTTTTCC
Edits in Original Sequence 
AAACCCAGCGATCATTTCTCCAAGAACATTACCCAAAAAAAAAAAACAAACAAGCACACAAAACA(5')ATGGGCATTGATTACTACCAT
TTATTGAAAGTACCGAAAAATGCAAGCGAAGAGGACCTGAAGAAGTCGTATAAGCGGCTCGCGATGAAGTGGCATCCGGATAAGAACAGC
GAGAACAAGAAAGAAGCGGAGGCCAAGTTCAAGACGATTTCAGAAGCGTATGATGTCTTAAGCGATCCCCAAAAGCGGCAGATCTATGAC
TTGTACGGCGAGGAAGGCCTCAAGTCCGGCCAGTTTTCTACTGCTTCACCTACTAGTGCTGGTGGCGCTGCTAGTGGGAGAGGATTTAAG
TTTAGCCCTCGGAATGCGGATGATATTTTTGCTGAGTTTTTCGGTGGATTCGACGGGAATTATGCTGTTAGCGGCGGCAATGGAGAGCTG
AAGAAGGCTGCGCCGATGGAGAATAAGCTTCCCTGTAGCTTGGAGGAGCTGTATAAAGGATCTAAAAGGAAGATGCAGATTTCCAGGATC
GTCCTTGATGACTATGGCAAGCCTGTGACCGTGGAAGAGGTGTTGTCAATACATATTAAACCAGGTTGGAAGAAGGGTACAAAGATTACA
TTCCCTGAGAAAGGGAACTACGAACTTGGTCGTGCTCCTGGGGATCTGATATTTGTAGTTGATGAAAAACCTCATGCTGTTTTCAAGAGG
GATGGCAATGATCTTGTCATGAATCAGAGGATTTCCTTGCTGGACGCTCTCACTGGGAAGACTCTCAGCTTGACAACCTTGGATGGAAGA
GAGCTGAGCATCCCAGTCAAAGATATTGTCAAACCTGGCCATGAGCTGAGGATCCCAAATGAAGGGATGCCCATATCAAAAGAACCTGGT
AAGAAAGGAAATTTGAGGATTAAGTTTGATATAAAATTCCCaTCCAGGCTCAGCTCAGAACAAAAATCTGAACTGCGGAGGGTACTTGGG
AGGACTGCTGATTaGTCCAAAATGAAGCACTGAAGAATATAGCtAACCAGTTATAGTGGAAACGCACCTGGATGTAAATACATCGTGACT
TTGCTTGGACTAGTAGGAAACACTGTGCATAATAGGAGTATaGTTTAATTCGGTCGCGTGCAATATATTTGAXGTTGTGTCTGGCCCCAA
GTGTAGCATATTGaGCTGGTGTTCTAGTGATCGATGTTAATTTTGGTGTTCAATGTTCAAATCTGTGGAATAGAAAXCCGAATAATGGTA
TTTTGGATTTGGTGGAGGTTGTCTGCCTCGTATTTTGTTGGCATAAATATCTTGATCCAGTTGtGTGAAAAGCCGGXGACCCCAATGCCC
CGTAAAGGGGGCCAAATGAcAGTACCCGGCCCCCCTTTTTAAAAAGGTTGAAAGAGGAACAAGTGCCAGCATTTACTTAGACAATGCAGC
TTATAGGAGCTTCATATACAACAAGTTTAATGTGAGCCCTGTGGAGATGGAAAGTGCTGCAGTGGCTCTCGTTTGCCATCAGCAAAGGGT
TCCTTTCATTGTCATTAGGGCACTTTCCGACTTGGCCGGCGGTGGCACCGCTGAATCCAATGAGGCTGCTACTTTCACTGCTCTTGCAGC
TGATAATTCTGXTCCAAGTTGTGGTGGAATTCCATCAGATTTTACTGTCTTTTCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan