Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U637526

Score 
547
Direction 
Forward
Predicted Peptide Sequence 
XGAAWKTADIEEGTTVAIFGLGVIGLAVAEGARLRGAKTIIGVDLNPDKVEIGKKFGITNFINPRELGGKLASEVILEMTDGLGADYCFE
CVGLPSLSQEAFTCCRKGWGKTIILGVDKPDSQFILNSLVNNHSGKTITGVQYGGLKPNLDIAILAKRYLDKELQLDLFVTHEIKLEDIN
KAFKLLIEGKCLRTVIWFDQERARADGVTFNEXIKEIRLTNTRQVLLYFRVDVC*NGLIQLRTIPLNLLKFCISQVKXRAPSMYSVSFDX
ALKFDKSSLQWVAKPYEIX
Predicted Coding Sequence 
XTAGGTGCTGCATGGAAAACAGCCGATATTGAAGAGGGTACAACTGTAGCTATTTTTGGATTGGGAGTAATTGGATTAGCGGTTGCTGAA
GGAGCAAGACTTCGTGGAGCTAAGACAATTATCGGTGTGGATCTGAACCCCGACAAAGTTGAAATAGGTAAAAAGTTTGGCATCACCAAT
TTTATCAACCCAAGGGAACTTGGCGGCAAACTTGCGAGCGAGGTGATTCTTGAGATGACTGATGGCCTTGGTGCTGATTACTGCTTTGAA
TGCGTGGGCTTGCCATCCCTATCACAAGAAGCATTTACTTGCTGCAGAAAGGGATGGGGAAAGACCATCATATTAGGAGTGGACAAGCCA
GACTCGCAGTTTATCCTCAACTCCCTAGTGAATAATCATAGCGGGAAGACCATCACAGGCGTCCAATATGGTGGTCTCAAGCCTAATCTT
GATATTGCCATTCTTGCAAAACGTTACTTGGATAAGGAGCTTCAGTTGGACTTGTTTGTCACGCATGAGATCAAACTTGAAGACATCAAC
AAGGCTTTCAAGTTGCTCATTGAGGGCAAGTGCCTCCGGACTGTCATTTGGTTCGATCAGGAGAGGGCAAGAGCCGATGGTGTGACATTT
AATGAAATXATAAAGGAGATTAGACTAACAAATACTAGACAAGTTCTGTTGTATTTTCGCGTTGACGTGTGTTAAAATGGTCTCATTCAA
TTGAGAACCATCCCTCTAAATTTGCTCAAGTTTTGTATTTCACAAGTTAAAXTGAGAGCCCCAAGCATGTATTCTGTTTCCTTTGATGXT
GCCTTGAAATTTGATAAATCCTCCCTTCAATGGGTTGCCAAACCATATGAGATTAXX
Edits in Original Sequence 
(5')XTAGGTGCTGCATGGAAAACAGCCGATATTGAAGAGGGTACAACTGTAGCTATTTTTGGATTGGGAGTAATTGGATTAGCGGTTGC
TGAAGGAGCAAGACTTCGTGGAGCTAAGACAATTATCGGTGTGGATCTGAACCCCGACAAAGTTGAAATAGGTAAAAAGTTTGGCATCAC
CAATTTTATCAACCCAAGGGAACTTGGCGGCAAACTTGCGAGCGAGGTGATTCTTGAGATGACTGATGGCCTTGGTGCTGATTACTGCTT
TGAATGCGTGGGCTTGCCATCCCTATCACAAGAAGCATTTACTTGCTGCAGAAAGGGATGGGGAAAGACCATCATATTAGGAGTGGACAA
GCCAGACTCGCAGTTTATCCTCAACTCCCTAGTGAATAATCATAGCGGGAAGACCATCACAGGCGTCCAATATGGTGGTCTCAAGCCTAA
TCTTGATATTGCCATTCTTGCAAAACGTTACTTGGATAAGGAGCTTCAGTTGGACTTGTTTGTCACGCATGAGATCAAACTTGAAGACAT
CAACAAGGCTTTCAAGTTGCTCATTGAGGGCAAGTGCCTCCGGACTGTCATTTGGTTCGATCAGGAGAGGGCAAGAGCCGATGGTGTGAC
ATTTAATGAAATXATAAAGGAGATTAGACTAACAAATACTAGACAAGTTCTGTTGTATTTTCGCGTTGACGTGTGTTAAAATGGTCTCAT
TCAATTGAGAACCATCCCTCTAAATTTGCTCAAGTTTTGTATTTCACAAGTTAAAXTGAGAGCCCCAAGCATGTATTCTGTTTCCTTTGA
TGXTGCCTTGAAATTTGATAAATCCTCCCTTCAATGGGTTGCCAAACCATATGAGATTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan