ESTScan Details for Unigene SGN-U637915

Score 
335
Direction 
Forward
Predicted Peptide Sequence 
XPGDYCNSSSIQTVKIPASGFFPSSSQAGSWNQQFTYPGRCPRESSPPPSPXDAPDRIPPIGKRDPKNSTSPPPGSESTFNDEFSLDYKP
*VNLQLPHFYDPKGEMNEVMTAADASSSLRPYSSPHSIYPSNLPLVSAXPRLSCCPISQDLYPLVQGEEMGFEKDASSGGMPSSHSATVT
ALAVAIGLQDGAGTSAFAIAVVLACVVMYDATGVRLHAGRQAELLNQIVCELPPEHPVANVRPLRDSLGHTPFQVVAGALLGCVVAYLLV
ALLRXGAGDSSEPSAKEAFVLSDSFRLQLDWSLQVERKELGVRNRILCGGRYAH*
Predicted Coding Sequence 
XGGCCGGGGGACTACTGTAATAGTAGTTCTATACAGACGGTGAAGATTCCAGCTTCCGGTTTCTTCCCATCTTCCTCGCAAGCTGGAAGT
TGGAACCAACAATTTACTTACCCGGGCAGGTGCCCGCGTGAGTCCTCACCACCACCCTCCCCCGXCGACGCCCCTGACCGAATTCCTCCA
ATTGGAAAGCGAGACCCAAAAAACTCCACGTCTCCACCTCCGGGATCCGAATCCACGTTCAACGACGAGTTTTCTCTAGATTATAAGCCC
TAAGTCAACCTGCAACTTCCACATTTTTATGATCCAAAAGGTGAAATGAACGAAGTAATGACGGCAGCTGATGCATCCTCCAGCTTACGC
CCATACTCATCTCCACACTCCATTTATCCCTCCAATCTCCCCCTTGTCTCCGCTXTTCCTCGCTTGTCTTGTTGCCCAATTTCTCAAGAT
CTTTACCCATTGGTTCAAGGAGAGGAAATGGGATTCGAGAAGGATGCTAGCTCTGGTGGAATGCCGTCATCACATTCAGCAACTGTTACT
GCTCTTGCTGTAGCAATAGGTTTGCAAGATGGAGCGGGAACATCTGCTTTTGCCATTGCGGTCGTTTTGGCATGTGTTGTAATGTATGAT
GCTACTGGTGTTAGGCTTCATGCCGGTCGGCAGGCTGAATTATTGAATCAGATAGTTTGTGAATTGCCCCCTGAACATCCTGTCGCTAAT
GTTAGGCCTCTGCGAGATTCACTTGGTCACACTCCTTTCCAGGTTGTTGCTGGTGCTTTGCTTGGATGTGTGGTAGCCTATCTCCTGGTA
GCTCTGCTTAGAXATGGTGCTGGTGATTCTTCAGAGCCAAGTGCTAAAGAGGCTTTTGTACTTTCTGATTCGTTCAGGCTGCAGCTTGAC
TGGTCGCTTCAAGTAGAAAGGAAAGAGCTAGGAGTTAGGAATCGGATCCTTTGTGGTGGAAGATACGCTCATTAA
Edits in Original Sequence 
(5')XGGCCGGGGGACTACTGTAATAGTAGTTCTATACtAGACGGTGAAGATTCCAGCTTCCGGTTTCTTCCCATCTTCCTCGCAAGCTG
GAAGTTGGAACCAACAATTTACTTAgCCCGGGCAGGTGCCCGCGTGAGTCCTCACCACCACCCTCCCCCGXCGACGCCCCTGACCGAATT
CCTCCAATTGGAAAGCGAGACCCAAAAAACTCCACGTCTCCACCTCCGGGATCCGAATCCACGTTCAACGACGtAGTTTTCTCTAGATTA
TAAGCCCTAAGTCAACCTGCAACTTCCACATTTTTATGATCCAAAAGGTGAAATGAACGAAGTAATGACGGCAGCTGATGCATCCTCCAG
CTTACGCCCATACTCATCTCCACACTCCATTTATCCCTCCAATCTCCCCCTTGTCTCCGCTXTTCCTCGCTTGTCTTGTTGCCCAATTTC
TCAAGATCTTTACCCATTGGTTCAAGGAGAGGAAATGGGATTCGAGAAGGATGCtTAGCTCTGGTGGAATGCCGTCATCACATTCAGCAA
CTGTTACTGCTCTTGCTGTAGCAATAGGTTTGCAAGATGGAGCGGGAACATCTGCTTTTGCCATTGCGGTCGTTTTGGCATGTGTTGTAA
TGTATGATGCTACTGGTGTTAGGCTTCATGCCGGTCGGCAGGCTGAATTATTGAATCAGATAGTTTGTGAATTGCCCCCTGAACATCCTG
TCGCTAATGTTAGGCCTCTGCGAGATTCACTTGGTCACACTCCTTTCCAGGTTGTTGCTGGTGCTTTGCTTGGATGTGTGGTAGCCTATC
TCCTGaGTAGCTCTGCTTAGAXATGGTGCTGGTGATTCTTCAGAGCCAAGTGCTAtAAGAGGCTTTTGTACTTTCTGATTCGTTCAGGCT
GCAGCTTGACTGGTCGCTTCAAGTAGAAAGGAAAGAGCTAGGAGTTAGGAATCGGATCCTTTGTGGTGGAAGATACGCTCATTAA(3')G
ACACGGTTTGGGAAATTTTGCGTGGTGGGGTCATTAGAGGGTGTGGGCGATCGAAACTGTGTATCGGTACAAGTAACATATATAATGTCA
TTTGTATTCTGTGTTATGGTATCCGTTTTCTAAGATCTTAGATAAGGAATATCCAGTGGAATTGGAGGCAATTCTCAACATTTGTATTTG
TGTACACATAGTCAACTTGGTGAGAAATGAGTTCTACTGTTGACTCAGTGACATATATAGTTGTTAGATTGTTGTCGATGCTAATCCCCT
GTAATTCATCCTCATCAATTAGATGAGATGTAGAATTGACGTGTAGCATGTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan