Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U644546

Score 
386
Direction 
Forward
Predicted Peptide Sequence 
TGKRDDTALHSAARAGNLKAVWEIIHQSSEEELIELLSKQNSAGETALYVAVEYGYLELVKEMIKYYDLAAAGIKARNGFYFLHIAAKQG
DLDIVKVLMEAHSELSMTVDTANTTALHTAATQGHIEVVNYLLELEIALAAIARSNGKT
Predicted Coding Sequence 
ACTGGGAAACGCGATGACACTGCATTGCATTCTGCTGCAAGAGCTGGAAATCTTAAAGCAGTATGGGAAATTATCCACCAGTCATCGGAG
GAAGAGTTAATAGAATTGTTGTCAAAGCAAAACTCAGCTGGGGAAACGGCATTATATGTTGCCGTGGAATATGGTTATCTAGAGTTAGTG
AAGGAGATGATTAAGTACTATGATCTTGCGGCCGCCGGGATCAAAGCAAGGAATGGTTTTTATTTTCTACATATAGCCGCCAAACAAGGG
GATTTGGATATCGTGAAGGTCCTAATGGAGGCTCATTCAGAGCTTTCCATGACAGTTGATACTGCAAACACTACAGCTCTGCATACTGCT
GCAACTCAAGGACACATTGAAGTGGTAAATTATCTATTGGAGCTGGAGATAGCCCTTGCTGCTATAGCTAGAAGTAATGGGAAGACX
Edits in Original Sequence 
(5')ACTGGGAAACGCGATGACACTGCATTGCATTCTGCTGCAAGAGCTGGAAATCTTAAAGCAGTATGGGAAATTATCCACCAGTCATC
GGAGGAAGAGTTAATAGAATTGTTGTCAAAGCAAAACTCAGCTGGGGAAACGGCATTATATGTTGCCGTGGAATATGGTTATCTAGAGTT
AGTGAAGGAGATGATTAAGTACTATGATCTTGCGGCCGCCGGGATCAAAGCAAGGAATGGTTTTTATTTTCTACATATAGCCGCCAAACA
AGGGGATTTGGATATCGTGAAGGTCCTAATGGAGGCTCATTCAGAGCTTTCCATGACAGTTGATACTGCAAACACTACAGCTCTGCATAC
TGCTGCAACTCAAGGACACATTGAAGTGGTAAATTATCTATTGGAGCTGGAGAgTAGCCCTTGCTGCTATAGCTAGAAGTAATGGGAAGA
CX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan