This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
Unigene Basic Information |
Unigene ID: | SGN-U577630 |
Unigene Build: | Tomato 200607 #2 |
Date: | 2009-03-25 |
Organism: | S.lycopersicum S.habrochaites S.pennellii S.pimpinellifolium S.peruvianum S.cheesmaniae S.lycopersicoides |
Alternative ID: | none |
mRNA sequence: | Length: 827 bp |
>SGN-U577630 Tomato 200607 #2 (444 members)
GGGGAAGCACAAATCGTACCATCTTGTAAGTTTGAGAAACGTCTAGTCTAGAGAGAAATGGCAAATCCAAAGGTTTTCTTTGACCTTACC
ATCGGTGGTGCACCAGCTGGTCGTGTGGTGATGGAGCTCTTCGCCGATACCACTCCCAAAACCGCTGAGAACTTCCGAGCTCTTTGTACC
GGTGAGAAAGGTGTTGGAAAGATGGGGAAGCCTTTGCACTACAAGGGCTCAACCTTCCACCGTGTGATCCCAGGGTTCATGTGTCAAGGA
GGTGATTTCACCGCCGGAAACGGGACCGGAGGAGAGTCGATCTATGGAGCCAAATTCAACGATGAGAACTTCGTTAAGAAGCACACCGGC
CCTGGAATCCTCTCCATGGCTAATGCTGGACCTGGAACCAACGGTTCTCAGTTTTTCATCTGTACCGCTAAGACTGAGTGGCTCAACGGA
AAGCACGTCGTGTTTGGACAAGTTGTTGAAGGCATGGATGTGATTAAGAAGGCAGAGGCTGTTGGATCTAGCTCTGGAAGGTGCTCCAAG
CCTGTGGTTATTGCTGACTGCGGTCAACTCTAGATCTGATGATGATGATGATCTAGTTTTATCAGTCTTTTATGTATTTGAGTCGCCGTT
TTAGGCTTTGTTTTTAATTTCAAACTATCTCTACTGCTTTGGTCGGGTCGTGTCGGGTCGAGTTCTAGGGTTAACCGTAATTGGTTGTTG
TGTTGCTTCTACCAGTTTATGTTTAATCTTAAGACTACAATTAAATAAGATACTCATAGACTTGCTAATGCTAAAATCGATTTTGTTGCT
TAAAAAAAAAAAAAAAA
[Blast] [AA Translation]
![]() ![]() |
Locus symbol | Locus name | Gene activity |
---|---|---|
cyp | cyclophilin | rotamase |
Solyc01g110700 | Solyc01g110700 | |
Solyc01g111180 | Solyc01g111180 |
Genomic locations (0) | None |
![]() ![]() |
Organism | Library | Description | Library size (#ESTs) | Ests in this Unigene |
---|---|---|---|---|
Solanum pennellii | cLPT | leaf trichomes 4-8 weeks old | 2729 | 4 |
Solanum lycopersicum | FA | Fruit Mixture of Immature green, mature green, breaker, turning, and red ripe stages | 13933 | 4 |
Solanum lycopersicum | FB | Fruit Mixture of Immature green, mature green, breaker, turning, and red ripe stages | 6270 | 30 |
Solanum lycopersicum | FC | Fruit Mixture of mature green, light green, breaker, turning, light red, and red ripe stages | 8046 | 9 |
Solanum lycopersicum | LB | Leaf Mature leaves | 3316 | 6 |
Solanum lycopersicum | LC | Leaf Mature leaves | 5712 | 3 |
Solanum lycopersicum | LE08 | Fruit 8 days post anthesis | 339 | 1 |
Solanum lycopersicum | LeMiToFr02 | fruit | 18697 | 1 |
Solanum lycopersicum | LeMiToLf01 | leaf | 30679 | 10 |
Solanum lycopersicum | LeTransC5 | Root 1.5-month old plants | 561 | 2 |
Solanum lycopersicum | LeTrich01 | Isolated leaf trichomes Apical internodes of 5-week old plants. | 7299 | 11 |
Solanum lycopersicum | Sl_LeafInf01 | Developmental stage | 125 | 3 |
Solanum lycopersicum | Sl_LeafWT01 | leaf 1.5-month old plants | 106 | 1 |
Solanum lycopersicum | Sl_RootGC02 | root Developing giant cell | 141 | 2 |
Solanum lycopersicum | Sl_RootInf02 | root and collar Three weeks old | 333 | 1 |
Solanum lycopersicum | TUS | Rearrayed collection of L. esculentum cDNA clones | 37722 | 59 |
Solanum lycopersicum | cLEB | vegetative shoots including meristems and small expanidng leaves 8 weeks | 898 | 4 |
Solanum lycopersicum | cLEC | combined undifferentiated and shooting callus 7-10 days post germination | 14114 | 7 |
Solanum lycopersicum | cLED | ovary 5 days pre-anthesis to 5 days post-anthesis | 9878 | 3 |
Solanum lycopersicum | cLEE | seeds and maturing carpels 5 days post-anthesis to fruit over-ripe stage | 547 | 1 |
Solanum lycopersicum | cLEF | fruit pericarp mature green | 5317 | 3 |
Solanum lycopersicum | cLEG | fruit pericarp breaker fruit | 15207 | 7 |
Solanum lycopersicum | cLEI | whole seedlings germinating seed | 3927 | 4 |
Solanum lycopersicum | cLEL | developing flower buds and flowers anthesis-stage flowers from full grown plants, 4-8 weeks old | 11276 | 70 |
Solanum lycopersicum | cLEM | fruit immature green fruit | 4240 | 5 |
Solanum lycopersicum | cLEN | fruit pericarp red ripe to over-ripe | 3979 | 1 |
Solanum lycopersicum | cLER | leaf 4 weeks | 5127 | 7 |
Solanum lycopersicum | cLES | leaf 4 weeks | 5243 | 15 |
Solanum lycopersicum | cLET | leaf 4-6 weeks | 9135 | 34 |
Solanum lycopersicum | cLEW | mixed roots grown under different nutrient and mineral difficiencies 4-8 weeks | 3175 | 3 |
Solanum lycopersicum | cLEX | root fruit-set stage/post-fruit loading | 3142 | 3 |
Solanum lycopersicum | cLEY | root pre-anthesis/pre-fruit loading | 3259 | 8 |
Solanum lycopersicum | cLEZ | root germinating seedlings | 2373 | 7 |
Solanum lycopersicum | cTOA | developing flower buds and flowers 0-3mm flower buds from full grown plants | 6259 | 14 |
Solanum lycopersicum | cTOB | developing flower buds and flowers 3-8mm flower buds from full grown plants | 5524 | 10 |
Solanum lycopersicum | cTOC | developing flower buds and flowers 8mm to pre-anthesis flower buds from full grown plants | 5759 | 9 |
Solanum lycopersicum | cTOD | flowers anthesis-stage flowers from full grown plants | 5642 | 2 |
Solanum lycopersicum | cTOE | Crown gall crown galls from full-grown plants (4-8 wks old) | 5204 | 4 |
Solanum lycopersicum | cTOF | shoot developing shoots from 4-6wks old plants | 9122 | 11 |
Solanum lycopersicum | cTOS | suspension cultures | 8026 | 10 |
Solanum lycopersicum | cTSB | seed | 1880 | 4 |
Solanum lycopersicum | cTSC | seed | 2256 | 7 |
Solanum lycopersicum | cTSD | seed | 1504 | 2 |
Solanum lycopersicum | vSlycmRNA | 8362 | 4 | |
Solanum habrochaites | LH_Ea | Glandular Trichomes | 3840 | 38 |
![]() ![]() |

To view details for a particular member sequence, click the SGN-E# identifier.
[Hide Image]
![]() ![]() |
Unigene Mapped Marker Information
No member sequence or clone is mapped.
|
COSII Markers Information
None cosii markers associated to this unigene.
|
![]() ![]() |
TOM1 data for Unigene: SGN-U577630
|
Expression data for Unigene: SGN-U577630
![]() |
![]() ![]() |
Manual annotations
|
Blast Annotations [Show All]
|
GO Terms Annotations
No Gene Ontology annotation
|
![]() ![]() |
Prediction based on ESTScan [ Show ESTScan Detail]
>SGN-P668750 (171 Aa)
SignalP analysis not run for this sequence.
>SGN-P668750 (171 Aa)
MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKF
NDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL*
NDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL*
SignalP analysis not run for this sequence.
No InterPro domain matches or not analyzed.
Prediction based on longest six frame method
>SGN-P709121 (173 Aa)
REMANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGA
KFNDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL
KFNDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL
SignalP analysis not run for this sequence.
No InterPro domain matches or not analyzed.
Gene Family (0) | None |
![]() ![]() |
Unigene | Build |
---|---|
SGN-U314547 | Tomato 200607 #1 |
SGN-U314548 | Tomato 200607 #1 |
SGN-U338797 | Tomato 200607 #1 |
SGN-U338800 | Tomato 200607 #1 |
SGN-U338801 | Tomato 200607 #1 |
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
Attribute | Value |
---|---|
Project Name: | |
Start Date: | |
End Date: | |
Event Type: | |
Event Description: | |
Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
